DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and psmb13a

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:196 Identity:50/196 - (25%)
Similarity:85/196 - (43%) Gaps:14/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EAVKQGAATVGLKGTDYAVLAALCRTSKD---TNTLQRKIMPVDDHVGMSIAGLTADARVVCQYM 88
            :|:|.|....|:...|..||.|..|.:.|   .:.:..||..:..::....||..||.......:
Zfish    39 KALKTGTTIAGVVFKDGVVLGADTRATSDEVVADKMCAKIHYIAPNIYCCGAGTAADTEKTTDML 103

  Fly    89 RTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDEQGPHIYQVMPTANV 153
            .:....:  |.|:....|.:::  .|.:|....|| ....|..|::.|.|..|.|:|.|.|..::
Zfish   104 SSNLTIF--SMNSGRNPRVVMA--VNIIQDMLFRY-HGMIGANLILGGVDCTGSHLYTVGPYGSM 163

  Fly   154 LNCKAMAIGSRSQSARTYLERNMESFEDCDMDE-LICHAIQA-IRGSLGSDDVENLTINVAIVGK 216
            .....:|:||...:|...||...:...|.:..: |:..|||| |...|||.:    .|::.::.|
Zfish   164 DKVPYLAMGSGDLAAMGILEDRFKVNMDLEQAKALVSDAIQAGIMCDLGSGN----NIDLCVITK 224

  Fly   217 D 217
            :
Zfish   225 E 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 50/196 (26%)
proteasome_alpha_type_1 6..215 CDD:239718 49/192 (26%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 47/190 (25%)
Pr_beta_C 241..272 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.