DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PSMB7

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_002790.1 Gene:PSMB7 / 5695 HGNCID:9544 Length:277 Species:Homo sapiens


Alignment Length:244 Identity:64/244 - (26%)
Similarity:96/244 - (39%) Gaps:47/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KQGAATVGLKGTDYAVLAALCRTSK-----DTNTLQRKIMPVDDHVGMSIAGLTADARVVCQYMR 89
            |.|....|:...|..||.|..|.::     |.|.  .||..:..::....||..||..:..|.:.
Human    41 KTGTTIAGVVYKDGIVLGADTRATEGMVVADKNC--SKIHFISPNIYCCGAGTAADTDMTTQLIS 103

  Fly    90 TECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPY-GVGLLVAGYDEQGPHIYQVMPTANV 153
            :....  ||.:.....|.:.:|  ..|:....||  :.| |..|::.|.|..|||:|.:.|..:.
Human   104 SNLEL--HSLSTGRLPRVVTAN--RMLKQMLFRY--QGYIGAALVLGGVDVTGPHLYSIYPHGST 162

  Fly   154 LNCKAMAIGSRSQSARTYLERNMESFED---CDMDE-----LICHAIQA-IRGSLGSDDVENLTI 209
            .....:.:||.|.:|       |..|||   .||:|     |:..||.| |...|||..    .|
Human   163 DKLPYVTMGSGSLAA-------MAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGS----NI 216

  Fly   210 NVAIVGKD---------VPFKMFTEAENQKYVKLVKAM----DPPLEAD 245
            ::.::.|:         ||.|..|.....:..|...|:    ..|||.:
Human   217 DLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 59/226 (26%)
proteasome_alpha_type_1 6..215 CDD:239718 54/199 (27%)
PSMB7NP_002790.1 proteasome_beta_type_7 44..232 CDD:239732 53/206 (26%)
Pr_beta_C 236..271 CDD:403609 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.