DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PSMB5

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_002788.1 Gene:PSMB5 / 5693 HGNCID:9542 Length:263 Species:Homo sapiens


Alignment Length:189 Identity:40/189 - (21%)
Similarity:81/189 - (42%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAATVGLKGTDYAVLAALCRTSKD---TNTLQRKIMPVDDHVGMSIAGLTADARVVCQYMRTECM 93
            |..|:..|.....::||..|.:..   .:...:|::.::.::..::||..||.....:.:..:|.
Human    59 GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCR 123

  Fly    94 AYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKA 158
            .| ...|.|   |..|:.....|.....:|......:|.::.|:|::||.:|.|....|.::...
Human   124 IY-ELRNKE---RISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGAT 184

  Fly   159 MAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAIRGSLGSDDVENLTINVAIVGKD 217
            .::||.|..|...::|...  .|.::::....|.:||..:...|......:|:..|.:|
Human   185 FSVGSGSVYAYGVMDRGYS--YDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRED 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 40/189 (21%)
proteasome_alpha_type_1 6..215 CDD:239718 38/185 (21%)
PSMB5NP_002788.1 proteasome_beta_type_5 60..247 CDD:239730 39/188 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.