DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PSMA2

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_002778.1 Gene:PSMA2 / 5683 HGNCID:9531 Length:234 Species:Homo sapiens


Alignment Length:247 Identity:73/247 - (29%)
Similarity:120/247 - (48%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTL------ 59
            |....|....||:||.|:|.|:|||:.||..||.:||:|..:..|||    |.|...::      
Human     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLA----TEKKQKSILYDERS 61

  Fly    60 QRKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYD 124
            ..|:.|:..|:|:..:|:..|.||:....|.....|...|....|..:||..:.:.:|..||...
Human    62 VHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGG 126

  Fly   125 RRPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELIC 189
            .||:||.||:.|::|..|:::|..|:......||.|:|....:.:|:||:...  ||.::::.|.
Human   127 VRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYN--EDLELEDAIH 189

  Fly   190 HAI----QAIRGSLGSDDVENLTINVAIVG--KDVPFKMFTEAENQKYVKLV 235
            .||    ::..|.:..|::|        ||  .:..|:..|..|.:.|:..:
Human   190 TAILTLKESFEGQMTEDNIE--------VGICNEAGFRRLTPTEVKDYLAAI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 72/240 (30%)
proteasome_alpha_type_1 6..215 CDD:239718 66/218 (30%)
PSMA2NP_002778.1 proteasome_alpha_type_2 6..231 CDD:239719 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.