DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and psma1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001008159.1 Gene:psma1 / 493521 XenbaseID:XB-GENE-995831 Length:261 Species:Xenopus tropicalis


Alignment Length:259 Identity:133/259 - (51%)
Similarity:185/259 - (71%) Gaps:10/259 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMP 65
            |||||||||.|.||||||:.|:||||||||||:||||||....|||.||.|...:....|:||:.
 Frog     1 MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKSQAVLVALKRAQSELAAHQKKILN 65

  Fly    66 VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGV 130
            ||:|||:||||||||||::|.:||.||:..|..::...||.||||.:|:|.|..||||.||||||
 Frog    66 VDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQIPTQRYGRRPYGV 130

  Fly   131 GLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAI 195
            |||:||||:.||||:|..|:||..:|:||:||:|||||||||||:|..|.||::::|:.|.::|:
 Frog   131 GLLIAGYDDMGPHIFQTSPSANYFDCRAMSIGARSQSARTYLERHMSEFLDCNLNDLVKHGLRAL 195

  Fly   196 RGSLGSD-DVENLTINVAIVGKDVPFKMFTEAENQKYV---------KLVKAMDPPLEADHDPL 249
            |.:|.:: |:....:::.||||::.|.::.:.|...::         |:....:.|:|...:|:
 Frog   196 RETLPAEQDLTTKNVSIGIVGKEMEFTIYDDDEVAPFLEGLEERPQRKVAPPAEEPVEKQEEPM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 126/238 (53%)
proteasome_alpha_type_1 6..215 CDD:239718 119/209 (57%)
psma1NP_001008159.1 proteasome_alpha_type_1 6..216 CDD:239718 119/209 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I2606
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 289 1.000 Inparanoid score I2754
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003679
OrthoInspector 1 1.000 - - otm48890
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2552
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.