DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosbeta1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:89/211 - (42%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VKQGAATVGLKGTDYAVLAALCRTSKD---TNTLQRKIMPVDDHVGMSIAGLTADARVVCQYMRT 90
            |..|...:.::.....|:.|..|||..   .|.:..|:..:.|.|....:|..||.:.:     .
  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAI-----A 71

  Fly    91 ECMAYRHSYNAEFPVR-RLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDEQ-GPHIYQVMPTANV 153
            :.:||..:|:.....: .||....::.:.....| |.....|::|||:||| |..:|.: |...:
  Fly    72 DIVAYSLNYHENQTNKDALVFEAASEFRNYCYSY-RESLLAGIIVAGWDEQRGGQVYSI-PLGGM 134

  Fly   154 LNCKAMAIGSRSQS-----ARTYLERNMESFEDCDMDELICHAIQAIRGSLGSDDVENLTINVAI 213
            |..::..||....|     .|.:...|| :.|||     :....:|::.::..|......:.:.|
  Fly   135 LTRESCTIGGSGSSFIYGFVREHYRPNM-ALEDC-----VTFVKKAVQHAIYHDGSSGGVVRIGI 193

  Fly   214 VGKD-VPFKMFTEAEN 228
            :.|| :..::|...|:
  Fly   194 ITKDGIERRIFYNTES 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 48/211 (23%)
proteasome_alpha_type_1 6..215 CDD:239718 44/195 (23%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 45/198 (23%)
proteasome_beta_type_6 16..203 CDD:239731 44/199 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.