DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosalpha1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster


Alignment Length:245 Identity:74/245 - (30%)
Similarity:120/245 - (48%) Gaps:20/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQ-GAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMP---- 65
            :|...|.:||:|||:|||||.:|:.| ...||.||..|.||:|    |.|  ...::.|:|    
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVA----TQK--KVTEKNIVPETVT 67

  Fly    66 ----VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRR 126
                :...:|.::.|..||:|...|..|.|...:|:.|..|.||..|...:.:..|..||..:.|
  Fly    68 HLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMR 132

  Fly   127 PYGVGLLVAGYD-EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICH 190
            |.|..:::..|| |.||.:|:..|.......||.::|:::..|.:|||:..:  .:...::.|..
  Fly   133 PLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYK--PNLSEEKAIQL 195

  Fly   191 AIQAIRGSLGSDDVENLTINVAIVGKDVP-FKMFTEAENQKYVKLVKAMD 239
            ||..:...|..|...| .|.:.:|.|..| |::..|.|.::::..:...|
  Fly   196 AISCLSSVLAIDFKPN-GIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 73/237 (31%)
proteasome_alpha_type_1 6..215 CDD:239718 67/218 (31%)
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 73/242 (30%)
proteasome_alpha_type_6 8..218 CDD:239723 67/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441033
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.