Sequence 1: | NP_609623.1 | Gene: | Prosalpha6T / 34726 | FlyBaseID: | FBgn0032492 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003889.1 | Gene: | psmb1 / 445413 | ZFINID: | ZDB-GENE-040618-2 | Length: | 237 | Species: | Danio rerio |
Alignment Length: | 211 | Identity: | 50/211 - (23%) |
---|---|---|---|
Similarity: | 85/211 - (40%) | Gaps: | 29/211 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 GAATVGLKGTDYAVLAALCRTSKDTNTLQR---KIMPVDDHVGMSIAGLTADARVVCQYMRTECM 93
Fly 94 AYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRR--PYGVGLLVAGYDEQG-PHIYQVMPTANVLN 155
Fly 156 CKAMAIGSRSQSARTYLE-----RNMESFEDCDMDELICHAIQAIRG---SLGSDDV-ENLTINV 211
Fly 212 AIVGKD------VPFK 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha6T | NP_609623.1 | PRE1 | 4..233 | CDD:223711 | 50/211 (24%) |
proteasome_alpha_type_1 | 6..215 | CDD:239718 | 46/197 (23%) | ||
psmb1 | NP_001003889.1 | PRE1 | 22..237 | CDD:223711 | 50/211 (24%) |
proteasome_beta_type_1 | 26..237 | CDD:239726 | 50/211 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |