DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and psma1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001003427.1 Gene:psma1 / 445033 ZFINID:ZDB-GENE-040801-15 Length:262 Species:Danio rerio


Alignment Length:226 Identity:130/226 - (57%)
Similarity:175/226 - (77%) Gaps:1/226 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMP 65
            |||||||||.|.||||||:.|:||||||||||:||||||...:|||.||.|...:....|:||:.
Zfish     1 MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSHSHAVLVALKRAQSELAAHQKKILH 65

  Fly    66 VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGV 130
            ||:|:|:||||||||||::|.:||.||:..|..::...||.||||.:|:|.|..||||.||||||
Zfish    66 VDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGV 130

  Fly   131 GLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAI 195
            |||:||||:.||||:|..|:||..:||||:||:|||||||||||:||:|.||:::.|:.|.::|:
Zfish   131 GLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMEAFNDCNLNALVQHGLRAL 195

  Fly   196 RGSLGSD-DVENLTINVAIVGKDVPFKMFTE 225
            |.:|.:: |:....:::.|||||:.|.::.:
Zfish   196 RETLPAEQDLTTKNVSIGIVGKDMEFTIYDD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 127/223 (57%)
proteasome_alpha_type_1 6..215 CDD:239718 120/209 (57%)
psma1NP_001003427.1 PRK03996 1..238 CDD:235192 130/226 (58%)
proteasome_alpha_type_1 6..216 CDD:239718 120/209 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578449
Domainoid 1 1.000 215 1.000 Domainoid score I2658
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2080
Inparanoid 1 1.050 290 1.000 Inparanoid score I2783
OMA 1 1.010 - - QHG53705
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003679
OrthoInspector 1 1.000 - - otm26455
orthoMCL 1 0.900 - - OOG6_102143
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1003
SonicParanoid 1 1.000 - - X2552
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.