DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:241 Identity:72/241 - (29%)
Similarity:118/241 - (48%) Gaps:16/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVL----AALCRTSKDTNTLQRKIM 64
            ::|....|.:||.|.|.|||||.|||::|:..||::|.:..||    :::....:|...  |||.
  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTV--RKIS 65

  Fly    65 PVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYG 129
            .:|.||.::.||||||||::....:.||.::|.::..:..:..:...|....|..||...|||:|
  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130

  Fly   130 VGLLVAGYDEQG-PHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFE---DCDMDELICH 190
            :..|:.|.|..| ..::...|:......||.|.|..:.:.|.:.|:.....|   .||..:|   
  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKL--- 192

  Fly   191 AIQAIRGSLGSDDVENLTINVAIVGKDVPFKMFTEAENQKYVKLVK 236
               |:|..|....:..:.:.||::....|.||.......:.||:|:
  Fly   193 ---AMRALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 69/236 (29%)
proteasome_alpha_type_1 6..215 CDD:239718 66/216 (31%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 72/239 (30%)
proteasome_alpha_type_7 5..213 CDD:239724 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.