DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosbeta3

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster


Alignment Length:204 Identity:43/204 - (21%)
Similarity:69/204 - (33%) Gaps:36/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAATVGLKGTDYAVLAALCRTSKDTNTLQ---RKIMPVDDHVGMSIAGLTADARVVCQYMRTECM 93
            |...|.::|.|...:|...|......|:.   :|:..:...:.:.:.||..|...|...:.....
  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKN 72

  Fly    94 AYRHSYNAEF---PVRRLVSNLGNKLQTTTQRYDRR--PYGVGLLVAGYDEQGPHIYQVMPTANV 153
            .|....|.|.   |...::|:.         .|:.|  ||.:..:|||.|.:         |...
  Fly    73 LYETRENREMCPKPFSAMMSSF---------LYEHRFGPYFIEPVVAGLDPK---------TMEP 119

  Fly   154 LNCKAMAIGSRSQS-----ARTYLERNMESFE-----DCDMDELICHAIQAIRGSLGSDDVENLT 208
            ..|....||..:..     |.|..|:.....|     |.:.|:|.....|:|..:...|.:....
  Fly   120 FICNMDLIGCPNAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWG 184

  Fly   209 INVAIVGKD 217
            ..|.|:.||
  Fly   185 ATVYIIEKD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 43/204 (21%)
proteasome_alpha_type_1 6..215 CDD:239718 41/200 (21%)
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 43/204 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.