DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosbeta2R2

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster


Alignment Length:263 Identity:43/263 - (16%)
Similarity:90/263 - (34%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAATVGLKGTDYAVLAALCRTSKDTNTLQ---RKIMPVDDHVGMSIAGLTADARVVCQYMRTECM 93
            |...||:......::.|..|.:.......   |||:.:..::..:.||...|.:.:.:..|.:..
  Fly    49 GTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLE 113

  Fly    94 AYRHSYN--------AEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDEQGPHIYQVMPT 150
            .:|.:..        |...:|:|:......:.            ..:::.|.|..|.|::.....
  Fly   114 LHRMNTGFRKVPVCCANQMIRQLLFRFNGNID------------ADMIIGGADNTGAHLFCTRSD 166

  Fly   151 ANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAIRGSLGSDDVENLTINVAIVG 215
            .:.......:|||..|.:.:.||....  ||...:.....|..|:...:.:|......:::.:|.
  Fly   167 GSTDTAPFTSIGSGYQVSMSILESRWS--EDLSEESACALACDAVAAGMKNDLCSGGKVSLCVVR 229

  Fly   216 KDV-------------PFKMFTEAENQKYVKLVKAMDPPLEADHDPLS--EEGMSDDDMTDHGPS 265
            .|.             |.:.:..:.......::..:..|:.:....|:  |.|.|.:  ...||.
  Fly   230 CDFSVQWPEQLPRQVPPTRTYRLSPKPGRTTILSTLVHPVLSWRGALALPEPGGSQE--PGRGPG 292

  Fly   266 SSG 268
            :||
  Fly   293 TSG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 34/224 (15%)
proteasome_alpha_type_1 6..215 CDD:239718 31/193 (16%)
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 31/192 (16%)
proteasome_beta_type_7 50..239 CDD:239732 32/202 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441164
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.