DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosbeta6

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:204 Identity:48/204 - (23%)
Similarity:82/204 - (40%) Gaps:27/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAATVGLKGTDYAVLAALCRTSKDTN---TLQRKIMPVDDHVGMSIAGLTADARVVCQYMRTECM 93
            |.:.|.:.|.|:||:||..|.|...|   ..|.|:..:.....:..||..||...:...::....
  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93

  Fly    94 AYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRR--PYGVGLLVAGYDEQGPH-IYQVMPTANVLN 155
            :|.|::........:...|      :...|:||  ||.|..::||.|.:|.. :|...|..:...
  Fly    94 SYEHTHLRTMTTEAVAQML------SIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEK 152

  Fly   156 CKAMAIGSRSQSARTYLE-----RNMESFEDCDMDELICHAIQAIRG----SLGSDDV---ENLT 208
            ....|.|:.....:..|:     :|| :.||.|..:|......::..    |....|:   :::.
  Fly   153 ATYRAGGTAGTLLQPVLDNQIGHKNM-NLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVL 216

  Fly   209 INVAIVGKD 217
            ||  |:.||
  Fly   217 IN--IITKD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 48/204 (24%)
proteasome_alpha_type_1 6..215 CDD:239718 46/200 (23%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 48/204 (24%)
PRE1 24..225 CDD:223711 48/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.