DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosalpha3

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster


Alignment Length:260 Identity:84/260 - (32%)
Similarity:131/260 - (50%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSK---DTNTLQRKIMPV 66
            :||:.||.:||:|||:||||||||:......:|:...|..:|||.||::.   |:.....||..:
  Fly     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68

  Fly    67 DDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVG 131
            :|::..|:||:|:||.|:...:|.....|:.||....|..:|||:|.:..|..||...:||:||.
  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133

  Fly   132 LLVAGYDEQ-GPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFED-----CDMDELICH 190
            ||..|:|.: |..:||..|:.|....||..||:...:|.:.|::.:...|:     .|..:|   
  Fly   134 LLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDL--- 195

  Fly   191 AIQAIRGSLGS-------------DDVENLTINVAIVGKDVP------FKMFTEAENQKYVKLVK 236
            ||:.:..:|.:             ..|:|.|:...:...||.      .|:..|||..|..|..|
  Fly   196 AIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAAKKEKQAK 260

  Fly   237  236
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 82/255 (32%)
proteasome_alpha_type_1 6..215 CDD:239718 75/230 (33%)
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 77/243 (32%)
proteasome_alpha_type_4 3..219 CDD:239721 72/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441155
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.