DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosalpha5

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:251 Identity:82/251 - (32%)
Similarity:133/251 - (52%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MF--RNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKD---TNTLQ 60
            ||  |::||....|:||:|||||||||:||:|.|:..:|:...:..|||...|.:..   .:|::
  Fly     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVE 65

  Fly    61 RKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVR---RLVSNL----GNKLQT 118
             ||:.||.|:|.:.:||.||||.:.:..|.||..:...||....:.   :.||.|    |:...:
  Fly    66 -KIVEVDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDS 129

  Fly   119 TTQRYDRRPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESF--ED 181
            .......||:||.:|.||.:...|.::.:.|:...:...|.||||.|:.|    ::|::..  .|
  Fly   130 DGAAAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGA----QQNLQDLFRPD 190

  Fly   182 CDMDELICHAI----QAIRGSLGSDDVENLTINVAIVGKDVPFKMFTEAENQKYVK 233
            ..:||.|..::    |.:...|.|.:||.:|:.     |:..|.|||:.|.::::|
  Fly   191 LTLDEAIDISLNTLKQVMEEKLNSTNVEVMTMT-----KEREFYMFTKEEVEQHIK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 78/244 (32%)
proteasome_alpha_type_1 6..215 CDD:239718 72/224 (32%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 79/244 (32%)
proteasome_alpha_type_5 8..222 CDD:239722 71/218 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.