DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psma8

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:247 Identity:96/247 - (38%)
Similarity:130/247 - (52%) Gaps:31/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQ-----RKI 63
            ::||...|.:||.|.|||||||.||||:|:..||::||:..||..   ..|....||     |||
  Rat     3 SRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGV---EKKSVAKLQDERTVRKI 64

  Fly    64 MPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPV-----RRLVSNLGNKLQTTTQRY 123
            ..:||||.|:.||||||||||....|.||.:  |....|.||     .|.::.|..|.   ||..
  Rat    65 CALDDHVCMAFAGLTADARVVISRARVECQS--HKLTVEDPVTVEYITRFIATLKQKY---TQSN 124

  Fly   124 DRRPYGVGLLVAGYDEQG-PHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDEL 187
            .|||:|:..|:.|:|:.| |.:||..|:......||.|||..:::.|.:||:|.......:.:|.
  Rat   125 GRRPFGISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDNEA 189

  Fly   188 ICHAIQAIRGSLGSDDVENLTINVAIVGKDVPFKMF---------TEAENQK 230
            |..||:|:...:.|.   ...|.:||:.:|.|.|||         ||.|.:|
  Rat   190 IKLAIKALLEVVQSG---GKNIELAIIRRDQPLKMFSAKEIELEVTEIEREK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 96/247 (39%)
proteasome_alpha_type_1 6..215 CDD:239718 87/219 (40%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 93/239 (39%)
proteasome_alpha_type_7 5..213 CDD:239724 86/218 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.