DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosbeta4

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:203 Identity:51/203 - (25%)
Similarity:80/203 - (39%) Gaps:42/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VGLKGTDYAVLAALCRTSKDTNTL---QRKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAY-- 95
            :|:||.|:.:|||....::....:   |.||..|.|.:.:|..|.:.|.....:::......|  
  Fly     5 LGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYKM 69

  Fly    96 RHSY------NAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYD-EQGPHIYQVMPTANV 153
            |:.|      :|.|..:.|...|.:          |.||.|.:.||||| ..||.:..:...||.
  Fly    70 RNGYDLSPRESAHFTRKNLAEYLRS----------RTPYQVFMFVAGYDPNAGPELTFIDYLANA 124

  Fly   154 LNCKAMAIGSRSQSARTYLER----NMESFEDCDMDELICHAIQAIRGSLGSDDVENLTIN---- 210
            |.......|..:..|.:..:|    |:...|..|:.:.....||           :.|.:|    
  Fly   125 LPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQ-----------KRLVVNLKNF 178

  Fly   211 -VAIVGKD 217
             ||:|.||
  Fly   179 TVAVVDKD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 51/203 (25%)
proteasome_alpha_type_1 6..215 CDD:239718 48/199 (24%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 51/203 (25%)
proteasome_beta_type_2 1..192 CDD:239727 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.