DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Prosbeta4R2

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster


Alignment Length:217 Identity:49/217 - (22%)
Similarity:84/217 - (38%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTL---QRKIMPVDDHVGMSIAGLTADARVVCQ 86
            |||.:      :|:||.|:.:||:....:|....:   |.||..:.|...|:..|...|......
  Fly     2 AMETI------LGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTD 60

  Fly    87 YMRTECMAYR--HSY--NAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDE-QGPHIYQ 146
            ::......|:  |.|  :|:.........|.:.::|.|:      |.|.:|:||||. :||.::.
  Fly    61 FISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTR------YQVAMLLAGYDAVEGPDLHY 119

  Fly   147 V------------------MPTANVL----NCKAMAIGSRSQSARTYLE------RNMESFEDCD 183
            :                  |...::|    |.|.....:.|...:..||      .|..:||...
  Fly   120 IDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYV 184

  Fly   184 MDELICHAIQAIR-GSLGSDDV 204
            :|......::||. |||..:.:
  Fly   185 VDSKGMRKMEAINPGSLNKESI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 49/217 (23%)
proteasome_alpha_type_1 6..215 CDD:239718 49/217 (23%)
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 44/203 (22%)
proteasome_beta_type_2 3..194 CDD:239727 43/202 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.