DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and psmb5

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_571226.1 Gene:psmb5 / 30387 ZFINID:ZDB-GENE-990415-215 Length:269 Species:Danio rerio


Alignment Length:184 Identity:42/184 - (22%)
Similarity:78/184 - (42%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMPVDDH 69
            ::.:.|||.:     |:.::.:.......||.|      |.:|:  :|.|       |::.::.:
Zfish    61 EFLHGTTTLA-----FKFQHGVIVAVDSRATAG------AYIAS--QTVK-------KVIEINPY 105

  Fly    70 VGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLV 134
            :..::||..||.....:.:..:|..| ...|.|   |..|:.....|.....:|......:|.:|
Zfish   106 LLGTMAGGAADCSFWERLLARQCRIY-ELRNKE---RISVAAASKLLANMVYQYKGMGLSMGTMV 166

  Fly   135 AGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSA----RTYLERNMESFEDCDM 184
            .|:|::||.:|.|....|.:.....|:||.|..|    .:.|..::...|.||:
Zfish   167 CGWDKRGPGLYYVDSEGNRVCGGLFAVGSGSMYAYGVVDSGLRYDLTIDEACDL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 42/184 (23%)
proteasome_alpha_type_1 6..215 CDD:239718 42/183 (23%)
psmb5NP_571226.1 PTZ00488 44..268 CDD:185666 42/184 (23%)
proteasome_beta_type_5 66..253 CDD:239730 42/179 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.