DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psma6

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_058979.1 Gene:Psma6 / 29673 RGDID:61849 Length:246 Species:Rattus norvegicus


Alignment Length:232 Identity:74/232 - (31%)
Similarity:121/232 - (52%) Gaps:16/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQGAAT-VGLKGTDYAVLAALCRTSK-------DTNTLQRK 62
            :|...|.:||:|||:|||||.:|:.||..| |.::|.|.||:.    |.|       |::|:.. 
  Rat     9 FDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIV----TQKKVPDKLLDSSTVTH- 68

  Fly    63 IMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRP 127
            :..:.:::|..:.|:|||:|...|..|.|...:::.|..|.||..|...:.:..|..||..:.||
  Rat    69 LFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRP 133

  Fly   128 YGVGLLVAGYD-EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHA 191
            .|..:::.|.| ||||.:|:..|.......||.|.|.:...:.::||:.::...|...::.:..|
  Rat   134 LGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETA 198

  Fly   192 IQAIRGSLGSDDVENLTINVAIVGKDVP-FKMFTEAE 227
            |..:...| |.|.:...|.|.:|..:.| |::.||||
  Rat   199 ITCLSTVL-SIDFKPSEIEVGVVTVENPKFRILTEAE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 74/232 (32%)
proteasome_alpha_type_1 6..215 CDD:239718 67/217 (31%)
Psma6NP_058979.1 proteasome_alpha_type_6 8..220 CDD:239723 67/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.