DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psma5

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_058978.2 Gene:Psma5 / 29672 RGDID:61848 Length:241 Species:Rattus norvegicus


Alignment Length:249 Identity:82/249 - (32%)
Similarity:137/249 - (55%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MF--RNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSK---DTNTLQ 60
            ||  |::||....|:||:|||||||||:||:|.|:..:|::.::...||...|.:.   :.::::
  Rat     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIE 65

  Fly    61 RKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVR---RLVSNLGNKLQTTTQR 122
             ||:.:|.|:|.:::||.|||:.:....|.|...:..:||....|.   :.||||.  ||...:.
  Rat    66 -KIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA--LQFGEED 127

  Fly   123 YD----RRPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLE----RNMESF 179
            .|    .||:||.||..|.||:||.::.:.|:...:.|.|.||||.|:.|::.|:    ::|...
  Rat   128 ADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK 192

  Fly   180 EDCDMDELICHAIQAIRGSLGSDDVENLTINVAIVGKDVPFKMFTEAENQKYVK 233
            |......:|..  |.:...|.:.::|..|:.   .|::  |.|||:.|.::.:|
  Rat   193 EAIKSSLIILK--QVMEEKLNATNIELATVQ---PGQN--FHMFTKEELEEVIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 78/242 (32%)
proteasome_alpha_type_1 6..215 CDD:239718 72/222 (32%)
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 71/216 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.