DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psma4

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:134/264 - (50%) Gaps:18/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSK---DTNTLQRKIMPV 66
            :||:.||.:||:|||:||||||||:......:|:...|..:|||..|...   |......||..:
  Rat     4 RYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKL 68

  Fly    67 DDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVG 131
            ::.:..|:||:|:||.|:...:|.....|...|....|..:||:.|.:..|..||...:||:||.
  Rat    69 NEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVS 133

  Fly   132 LLVAGYDEQ-GPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAI 195
            ||..|:|:. |..:||..|:.|....||..||:.|.:|.:.|:::.:..| ..:...:..|::.:
  Rat   134 LLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGE-MTLKSALALAVKVL 197

  Fly   196 RGSLGSDDVENLT---INVAIV----GKDVPFKMFTEAENQKYVKLVKAMDPPLEADHDPLSEEG 253
            ..::   ||..|:   :.:|.:    ||.| .::..:.|.::.:|  |..:...:|:.:...:|.
  Rat   198 NKTM---DVSKLSAEKVEIATLTRENGKTV-IRVLKQKEVEQLIK--KHEEEEAKAEREKKEKEQ 256

  Fly   254 MSDD 257
            ...|
  Rat   257 REKD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 73/238 (31%)
proteasome_alpha_type_1 6..215 CDD:239718 69/219 (32%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 69/215 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.