DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psma3

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_058976.1 Gene:Psma3 / 29670 RGDID:61844 Length:255 Species:Rattus norvegicus


Alignment Length:282 Identity:75/282 - (26%)
Similarity:117/282 - (41%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLK-------GTDYAVLAALCRTSKDTNTLQRKI 63
            ||...:|:||.||:|||||||:||:..:..:|::       |.:..||:.|.....:     :::
  Rat     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSN-----KRL 67

  Fly    64 MPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPY 128
            ..||.||||::|||.||||.:....|.|...:|.::....|::.|...:...:...|.....||:
  Rat    68 FNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPF 132

  Fly   129 GVGLLVAGYD-EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAI 192
            |...::..|. ..|..:|.:.|:.........|||...|:|:|.:|:       ..|.|:.|.  
  Rat   133 GCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEK-------LQMKEMTCR-- 188

  Fly   193 QAIRGSLGSDDVENLTINVAIVGKDVPFKMF---------------------TEAENQKYVKLVK 236
                     |.|:.:...:.||..:|..|.|                     ...|.:||.|   
  Rat   189 ---------DVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYAK--- 241

  Fly   237 AMDPPLEADHDPLSEEGMSDDD 258
                      :.|.||..||||
  Rat   242 ----------ESLKEEDESDDD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 67/255 (26%)
proteasome_alpha_type_1 6..215 CDD:239718 60/216 (28%)
Psma3NP_058976.1 proteasome_alpha_type_3 5..217 CDD:239720 64/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.