DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psma1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_036095.1 Gene:Psma1 / 26440 MGIID:1347005 Length:263 Species:Mus musculus


Alignment Length:261 Identity:135/261 - (51%)
Similarity:185/261 - (70%) Gaps:12/261 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMP 65
            |||||||||.|.||||||:.|:||||||||||:||||||...:|||.||.|...:....|:||:.
Mouse     1 MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILH 65

  Fly    66 VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGV 130
            ||:|:|:||||||||||::|.:||.||:..|..::...||.||||.:|:|.|..||||.||||||
Mouse    66 VDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGV 130

  Fly   131 GLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAI 195
            |||:||||:.||||:|..|:||..:|:||:||:|||||||||||:|..|.:|::|||:.|.::|:
Mouse   131 GLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLDELVKHGLRAL 195

  Fly   196 RGSLGSD-DVENLTINVAIVGKDVPFKMF-----------TEAENQKYVKLVKAMDPPLEADHDP 248
            |.:|.:: |:....:::.|||||:.|.::           .|...|:..:..:|.:.|.|...:|
Mouse   196 RETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERPQRKAQPSQAAEEPAEKADEP 260

  Fly   249 L 249
            :
Mouse   261 M 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 128/240 (53%)
proteasome_alpha_type_1 6..215 CDD:239718 119/209 (57%)
Psma1NP_036095.1 proteasome_alpha_type_1 6..216 CDD:239718 119/209 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835237
Domainoid 1 1.000 218 1.000 Domainoid score I2646
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2080
Inparanoid 1 1.050 292 1.000 Inparanoid score I2759
Isobase 1 0.950 - 0 Normalized mean entropy S372
OMA 1 1.010 - - QHG53705
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003679
OrthoInspector 1 1.000 - - otm43718
orthoMCL 1 0.900 - - OOG6_102143
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1003
SonicParanoid 1 1.000 - - X2552
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.