DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psmb8

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_542945.2 Gene:Psmb8 / 24968 RGDID:3426 Length:276 Species:Rattus norvegicus


Alignment Length:225 Identity:54/225 - (24%)
Similarity:93/225 - (41%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDT--NTLQ-RKI 63
            |...:.:|      |.|..|:|.|     .|..|:..|.....::|...|.|..:  .|:: .|:
  Rat    53 FLRSFGDD------QERKVQIEMA-----HGTTTLAFKFQHGVIVAVDSRASAGSYIATIRVNKV 106

  Fly    64 MPVDDHVGMSIAGLTADARVVCQY----MRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYD 124
            :.::.::..:::|..||    |||    :..||..| :..|.|   |..||.....|.....:|.
  Rat   107 IEINPYLLGTMSGCAAD----CQYWERLLAKECRLY-YLRNGE---RISVSAASKLLSNMMLQYR 163

  Fly   125 RRPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMES--FEDCDMDEL 187
            .....:|.::.|:|::||.:|.|......|:.:..:.|    |..||....|:|  .:|...:|.
  Rat   164 GMGLSMGSMICGWDKKGPGLYYVDDNGTRLSGQMFSTG----SGNTYAYGVMDSGYRQDLSPEEA 224

  Fly   188 ICHAIQAIRGSLGSDDVENLTINVAIVGKD 217
            ...|.:||..:...|......:|:..:.||
  Rat   225 YDLARRAIVYATHRDSYSGGVVNMYHMKKD 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 53/223 (24%)
proteasome_alpha_type_1 6..215 CDD:239718 51/217 (24%)
Psmb8NP_542945.2 PTZ00488 40..271 CDD:185666 54/225 (24%)
proteasome_beta_type_5 73..260 CDD:239730 46/194 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.