DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and CG30382

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:245 Identity:74/245 - (30%)
Similarity:120/245 - (48%) Gaps:20/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQ-GAATVGLKGTDYAVLAALCRTSKDTNTLQRKIMP---- 65
            :|...|.:||:|||:|||||.:|:.| ...||.||..|.||:|    |.|  ...::.|:|    
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVA----TQK--KVTEKNIVPETVT 67

  Fly    66 ----VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRR 126
                :...:|.::.|..||:|...|..|.|...:|:.|..|.||..|...:.:..|..||..:.|
  Fly    68 HLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMR 132

  Fly   127 PYGVGLLVAGYD-EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICH 190
            |.|..:::..|| |.||.:|:..|.......||.::|:::..|.:|||:..:  .:...::.|..
  Fly   133 PLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYK--PNLSEEKAIQL 195

  Fly   191 AIQAIRGSLGSDDVENLTINVAIVGKDVP-FKMFTEAENQKYVKLVKAMD 239
            ||..:...|..|...| .|.:.:|.|..| |::..|.|.::::..:...|
  Fly   196 AISCLSSVLAIDFKPN-GIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 73/237 (31%)
proteasome_alpha_type_1 6..215 CDD:239718 67/218 (31%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 73/242 (30%)
proteasome_alpha_type_6 8..218 CDD:239723 67/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.