DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psmb7

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_035317.1 Gene:Psmb7 / 19177 MGIID:107637 Length:277 Species:Mus musculus


Alignment Length:228 Identity:61/228 - (26%)
Similarity:92/228 - (40%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EAVKQGAATVGLKGTDYAVLAALCRTSK-----DTNTLQRKIMPVDDHVGMSIAGLTADARVVCQ 86
            :|.|.|....|:...|..||.|..|.::     |.|.  .||..:..::....||..||..:..|
Mouse    38 KARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNC--SKIHFISPNIYCCGAGTAADTDMTTQ 100

  Fly    87 YMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPY-GVGLLVAGYDEQGPHIYQVMPT 150
            .:.:....  ||.......|.:.:|  ..|:....||  :.| |..|::.|.|..|||:|.:.|.
Mouse   101 LISSNLEL--HSLTTGRLPRVVTAN--RMLKQMLFRY--QGYIGAALVLGGVDVTGPHLYSIYPH 159

  Fly   151 ANVLNCKAMAIGSRSQSARTYLERNMESFED---CDMDE-----LICHAIQA-IRGSLGSDDVEN 206
            .:......:.:||.|.:|       |..|||   .||:|     |:..||.| |...|||..   
Mouse   160 GSTDKLPYVTMGSGSLAA-------MAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGS--- 214

  Fly   207 LTINVAIVGKDV-----PFKMFTEAENQKYVKL 234
             .|::.::.|..     ||.:    .|:|..:|
Mouse   215 -NIDLCVISKSKLDFLRPFSV----PNKKGTRL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 60/225 (27%)
proteasome_alpha_type_1 6..215 CDD:239718 55/202 (27%)
Psmb7NP_035317.1 PRE1 41..225 CDD:223711 55/202 (27%)
proteasome_beta_type_7 44..232 CDD:239732 53/206 (26%)
Pr_beta_C 236..271 CDD:289249 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.