DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psmb10

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:232 Identity:61/232 - (26%)
Similarity:87/232 - (37%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQR---KIMPVDDHVGMSIAGLTADARVVCQYMR 89
            |.|.|....||...|..:|.|..|.:.|:....:   ||..:...:....||:.||..     |.
Mouse    35 ARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTE-----MT 94

  Fly    90 TECMAYRHSYNAEFPVRR-LVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDEQGPHIYQVMPTANV 153
            |...|.:...:|....|. .|:.:...|:.|..||... .|..|:|.|.|..||.:|:|.|..:.
Mouse    95 TRMAASKMELHALSTGREPRVATVTRILRQTLFRYQGH-VGASLVVGGVDLNGPQLYEVHPHGSY 158

  Fly   154 LNCKAMAIGSRSQSARTYLERNMESFEDCD-MDELICHAIQA-IRGSLGSDDVENLTINVAIVGK 216
            ......|:||...:|...||...:.....: ..||:..||.| |...|||             |.
Mouse   159 SRLPFTALGSGQGAAVALLEDRFQPNMTLEAAQELLVEAITAGILSDLGS-------------GG 210

  Fly   217 DVPFKMFTEAENQKYVKLVKAMDPPLEADHDPLSEEG 253
            :|...:.|...    .||.:|:..|.|    |:...|
Mouse   211 NVDACVITAGG----AKLQRALSTPTE----PVQRAG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 54/210 (26%)
proteasome_alpha_type_1 6..215 CDD:239718 51/192 (27%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 58/225 (26%)
proteasome_beta_type_7 40..226 CDD:239732 53/208 (25%)
Pr_beta_C 232..267 CDD:289249 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.