DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psmb1

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_035315.1 Gene:Psmb1 / 19170 MGIID:104884 Length:240 Species:Mus musculus


Alignment Length:182 Identity:42/182 - (23%)
Similarity:72/182 - (39%) Gaps:26/182 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PQGRLFQVE-----YAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQR---KIMPVDDHVG 71
            |.|....|:     ||.    .|...:.:.|.|::::|:..|.|:..:...|   |...:.|...
Mouse    18 PHGSAGPVQLRFSPYAF----NGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTV 78

  Fly    72 MSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRR--PYGVGLLV 134
            :..:|...|...:.:.:......|:||.|.......:.:.|      :|..|.||  ||.|..::
Mouse    79 IGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAML------STILYSRRFFPYYVYNII 137

  Fly   135 AGYDEQGP-HIYQVMPTANVLNCKAMAIGSRSQSARTYLE-----RNMESFE 180
            .|.||:|. .:|...|..:.......|.||.|...:..|:     :||::.|
Mouse   138 GGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 42/182 (23%)
proteasome_alpha_type_1 6..215 CDD:239718 42/182 (23%)
Psmb1NP_035315.1 PRE1 18..240 CDD:223711 42/182 (23%)
proteasome_beta_type_1 29..240 CDD:239726 39/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.