DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psma3

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_035314.3 Gene:Psma3 / 19167 MGIID:104883 Length:255 Species:Mus musculus


Alignment Length:282 Identity:75/282 - (26%)
Similarity:117/282 - (41%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLK-------GTDYAVLAALCRTSKDTNTLQRKI 63
            ||...:|:||.||:|||||||:||:..:..:|::       |.:..||:.|.....:     :::
Mouse     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSN-----KRL 67

  Fly    64 MPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPY 128
            ..||.||||::|||.||||.:....|.|...:|.::....|::.|...:...:...|.....||:
Mouse    68 FNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPF 132

  Fly   129 GVGLLVAGYD-EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAI 192
            |...::..|. ..|..:|.:.|:.........|||...|:|:|.:|:       ..|.|:.|.  
Mouse   133 GCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEK-------LQMKEMTCR-- 188

  Fly   193 QAIRGSLGSDDVENLTINVAIVGKDVPFKMF---------------------TEAENQKYVKLVK 236
                     |.|:.:...:.||..:|..|.|                     ...|.:||.|   
Mouse   189 ---------DVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYAK--- 241

  Fly   237 AMDPPLEADHDPLSEEGMSDDD 258
                      :.|.||..||||
Mouse   242 ----------ESLKEEDESDDD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 67/255 (26%)
proteasome_alpha_type_1 6..215 CDD:239718 60/216 (28%)
Psma3NP_035314.3 proteasome_alpha_type_3 5..217 CDD:239720 64/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.