DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and pas-2

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_505750.1 Gene:pas-2 / 179493 WormBaseID:WBGene00003923 Length:231 Species:Caenorhabditis elegans


Alignment Length:215 Identity:71/215 - (33%)
Similarity:111/215 - (51%) Gaps:12/215 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTL---QRKIMP 65
            :.|....||:||.|:|.|:|||:.|||.|..:|||:..|..|||    |....:.|   |.|:..
 Worm     3 DHYGFSLTTFSPSGKLMQIEYALNAVKNGQPSVGLRAKDGVVLA----TENVGSVLTDDQPKVEQ 63

  Fly    66 VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGV 130
            :..|:|...:|:..|.|::.:..|...|.|...|..|.|..:||:::...:|..||....||:|.
 Worm    64 ISKHIGCVYSGMGPDFRILVKKARKIAMEYEMMYGEEMPTIQLVTDIAAVMQEYTQSGGVRPFGA 128

  Fly   131 GLLVAGYDEQ--GPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQ 193
            .||:||:|:.  .|.::|..|:......||.|:|....:|:|:||:...  |..::|:.|..|:.
 Worm   129 SLLIAGWDKNPGRPLLFQCDPSGAYFAWKATALGKNDVNAKTFLEKRFS--EALELDDGIHTALL 191

  Fly   194 AIRGSLGSDDVENLTINVAI 213
            .:|.|......|| .:.||:
 Worm   192 TLRESFDVGMNEN-NVEVAV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 71/215 (33%)
proteasome_alpha_type_1 6..215 CDD:239718 71/213 (33%)
pas-2NP_505750.1 proteasome_alpha_type_2 5..229 CDD:239719 71/213 (33%)
PRK03996 10..228 CDD:235192 70/208 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.