DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and pbs-6

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_498806.1 Gene:pbs-6 / 176161 WormBaseID:WBGene00003952 Length:258 Species:Caenorhabditis elegans


Alignment Length:235 Identity:57/235 - (24%)
Similarity:98/235 - (41%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCR-TSKDTNTLQR---KIMPVDDHVGMS 73
            |:|        |:||    |.:|..:.|.::|::|:..| |..|.|.|.|   ||..::|::.::
 Worm    44 WNP--------YSME----GGSTCAISGENFAIVASDTRMTQNDINILTRDAEKIQILNDNIILT 96

  Fly    74 IAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRR--PYGVGLLVAG 136
            .:|...|...:.:.:::....||..|.::..|......|...|      |.||  ||..|.::||
 Worm    97 TSGFYGDVLQLKKVLQSRLHKYRFDYRSDMSVDLCAELLSRNL------YYRRFFPYYTGAILAG 155

  Fly   137 YDEQGP-HIYQVMPTANVLNCKAMAIGSRSQSARTYLERNM------ESFE--DCDMDELICHAI 192
            .||.|. .::...|...:......|.|:.......:|:..:      |.:|  :..:|..|....
 Worm   156 IDEHGKGAVFSYDPIGCIERLGYSASGAAEPMIIPFLDCQIGHVTLSEGYERPELTLDRAISLMK 220

  Fly   193 QAIRGS----LGSDDVENLTINVAIVGKDVPFKMFTEAEN 228
            .:.||:    :.:.|..:|.|  |..||.|..|.....|:
 Worm   221 DSFRGAAEREISTGDKIHLVI--AEAGKPVVVKFLPLRED 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 57/235 (24%)
proteasome_alpha_type_1 6..215 CDD:239718 52/220 (24%)
pbs-6NP_498806.1 PRE1 38..246 CDD:223711 52/221 (24%)
Ntn_hydrolase 44..258 CDD:294319 56/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.