DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and pbs-2

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:148 Identity:38/148 - (25%)
Similarity:58/148 - (39%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 AGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPY--------GVG 131
            ||..||...|.:.:         |.|    :|.|..|.|.|.:..|.....:.:        |..
 Worm    92 AGTAADLDQVTKML---------SGN----LRLLELNTGRKARVITALRQAKQHLFNYQGYIGAY 143

  Fly   132 LLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAIR 196
            ||:.|.|..|||:|........:.....|.||.|.:|.|.|||:.:  .|...||......:|:.
 Worm   144 LLIGGVDPTGPHLYMCSANGTTMAFPFTAQGSGSYAAITILERDFK--VDMTKDEAEKLVQRALE 206

  Fly   197 GSLGSDDVENLTINVAIV 214
            ..:..|:....::|:.|:
 Worm   207 AGMHGDNASGNSLNLVII 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 38/148 (26%)
proteasome_alpha_type_1 6..215 CDD:239718 38/148 (26%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 38/148 (26%)
proteasome_beta_type_7 47..235 CDD:239732 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.