DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and Psmb8

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_034854.2 Gene:Psmb8 / 16913 MGIID:1346527 Length:276 Species:Mus musculus


Alignment Length:211 Identity:50/211 - (23%)
Similarity:87/211 - (41%) Gaps:26/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QGRLFQVEYAMEAVKQGAATVGLK---GTDYAVLAALCRTSKDTNTLQRKIMPVDDHVGMSIAGL 77
            |.|..|:|.|     .|..|:..|   |...||.:.....|..::....|::.::.::..:::|.
Mouse    61 QERNVQIEMA-----HGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGC 120

  Fly    78 TADARVVCQY----MRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYD 138
            .||    |||    :..||..| :..|.|   |..||.....|.....:|......:|.::.|:|
Mouse   121 AAD----CQYWERLLAKECRLY-YLRNGE---RISVSAASKLLSNMMLQYRGMGLSMGSMICGWD 177

  Fly   139 EQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMES--FEDCDMDELICHAIQAIRGSLGS 201
            ::||.:|.|......|:.:..:.|    |..||....|:|  .:|...:|......:||..:...
Mouse   178 KKGPGLYYVDDNGTRLSGQMFSTG----SGNTYAYGVMDSGYRQDLSPEEAYDLGRRAIAYATHR 238

  Fly   202 DDVENLTINVAIVGKD 217
            |:.....:|:..:.:|
Mouse   239 DNYSGGVVNMYHMKED 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 50/211 (24%)
proteasome_alpha_type_1 6..215 CDD:239718 49/207 (24%)
Psmb8NP_034854.2 PTZ00488 40..271 CDD:185666 50/211 (24%)
proteasome_beta_type_5 73..260 CDD:239730 44/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.