DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and PSMA8

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_653263.2 Gene:PSMA8 / 143471 HGNCID:22985 Length:256 Species:Homo sapiens


Alignment Length:246 Identity:93/246 - (37%)
Similarity:127/246 - (51%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQ-----RKI 63
            ::||...|.:||.|.|||||||.||||:|:..||::||:..||..   ..|....||     |||
Human     3 SRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGV---EKKSVAKLQDERTVRKI 64

  Fly    64 MPVDDHVGMSIA------GLTADARVVCQYMRTECMAYRHSYNAEFPV-----RRLVSNLGNKLQ 117
            ..:||||.|:.|      |||||||||....|.||.:  |....|.||     .|.::.|..|. 
Human    65 CALDDHVCMAFAVLTIFIGLTADARVVINRARVECQS--HKLTVEDPVTVEYITRFIATLKQKY- 126

  Fly   118 TTTQRYDRRPYGVGLLVAGYDEQG-PHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFED 181
              ||...|||:|:..|:.|:|:.| ..:||..|:......||.|||..:::.|.:||:|......
Human   127 --TQSNGRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAI 189

  Fly   182 CDMDELICHAIQAIRGSLGSDDVENLTINVAIVGKDVPFKMFTEAENQKYV 232
            ....|.|..||:|:...:.|.   ...|.:||:.::.|.|||:..|.:.||
Human   190 ASDSEAIKLAIKALLEVVQSG---GKNIELAIIRRNQPLKMFSAKEVELYV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 93/246 (38%)
proteasome_alpha_type_1 6..215 CDD:239718 86/225 (38%)
PSMA8NP_653263.2 PRK03996 5..237 CDD:235192 91/242 (38%)
proteasome_alpha_type_7 5..219 CDD:239724 85/224 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.