DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and AT4G15165

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001190735.1 Gene:AT4G15165 / 10723067 AraportID:AT4G15165 Length:208 Species:Arabidopsis thaliana


Alignment Length:200 Identity:55/200 - (27%)
Similarity:97/200 - (48%) Gaps:46/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCR-TSK--DTNTLQRKIMPV 66
            :||:.||.:||:|||:||||||||:....:.:|:...|..||....: |||  .|::...|:..:
plant     4 RYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILAKDGVVLVGEKKVTSKLLQTSSSMEKMYKI 68

  Fly    67 DDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGVG 131
            ||||..::||:.:||.:                            |.|..:...||:||      
plant    69 DDHVACAVAGIMSDANI----------------------------LINTARVQAQRWDR------ 99

  Fly   132 LLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAIR 196
                   ..|..:|...|:.|....:|.|:|:.:|:|::.|:::.:  :|...:|::..||:.:.
plant   100 -------NHGFQLYMSDPSGNYGGWQAAAVGANNQAAQSILKQDYK--DDATREEVVQLAIKVLS 155

  Fly   197 GSLGS 201
            .::.|
plant   156 KTMDS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 54/199 (27%)
proteasome_alpha_type_1 6..215 CDD:239718 54/198 (27%)
AT4G15165NP_001190735.1 Ntn_hydrolase 3..173 CDD:382028 54/199 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.