DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6T and psmb5

DIOPT Version :9

Sequence 1:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_002941560.1 Gene:psmb5 / 100379732 XenbaseID:XB-GENE-975048 Length:257 Species:Xenopus tropicalis


Alignment Length:210 Identity:54/210 - (25%)
Similarity:89/210 - (42%) Gaps:29/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GRLFQVEYAMEAVKQGAATVG---LKGTD-------YAVLAALCRTSKDT------NTLQRKIMP 65
            |..|||   :....:|||..|   |.||.       :.|:.|:  .|:.|      :...:|::.
 Frog    30 GTSFQV---LPGAGEGAAEPGIEFLHGTTTLAFKFRHGVIVAV--DSRATAGAYIASQTVKKVIE 89

  Fly    66 VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGV 130
            ::.::..::||..||.....:.:..:|..| ...|.|   |..|:.....|.....:|......:
 Frog    90 INPYLLGTMAGGAADCSFWERLLARQCRIY-ELRNKE---RISVAAASKLLANMVYQYKGMGLSM 150

  Fly   131 GLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLER--NMESFEDCDMDELICHAI- 192
            |.::.|:|::||.:|.|....|.::....::||.|..|...|:|  |.| .|..:..||...:| 
 Frog   151 GTMICGWDKRGPGLYYVDSEGNRVSGSVFSVGSGSMYAYGVLDRGYNYE-MEVEEAQELARRSIY 214

  Fly   193 QAIRGSLGSDDVENL 207
            ||......|..|.||
 Frog   215 QATYRDAYSGGVVNL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 54/210 (26%)
proteasome_alpha_type_1 6..215 CDD:239718 54/210 (26%)
psmb5XP_002941560.1 proteasome_beta_type_5 54..241 CDD:239730 44/183 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.