DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16815 and CG16813

DIOPT Version :9

Sequence 1:NP_609622.2 Gene:CG16815 / 34725 FlyBaseID:FBgn0032491 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001260438.1 Gene:CG16813 / 34724 FlyBaseID:FBgn0032490 Length:184 Species:Drosophila melanogaster


Alignment Length:187 Identity:83/187 - (44%)
Similarity:105/187 - (56%) Gaps:25/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENSSSYTHKKF-AVSKRKREVDHDKENQT---------QQSEQPIFKRRQTQGFFRPWLD---- 51
            |:|   |.|||| ...||||.:|.|.::..         :..|||..|||    |||||:|    
  Fly     1 MDN---YNHKKFTGALKRKRSMDADSDDDVVFIMEQPGQRTPEQPQPKRR----FFRPWMDESPE 58

  Fly    52 NEQNQQAEKETSTAAKPSGPGSSVSQYRANMVRRSNTNRQRSPKEQMRRDRNTLACLLSRRAKQA 116
            .||.|...|..:|:..|  |......|.|||||..:..|||||:||:||||||||.|..||::|.
  Fly    59 EEQPQPPRKIVATSTPP--PQQVDGTYHANMVRNHHKRRQRSPQEQLRRDRNTLASLRHRRSQQQ 121

  Fly   117 QEEQVGQQYEQYRSHHAAMLEQQVRLSLYYRHILQQAVFQRAINP--APGHILPQQQ 171
            |::.:.|||...|..|.|.|:||:||||||...||||:......|  .|.|::|:||
  Fly   122 QQQLIEQQYLTSRIQHEANLQQQIRLSLYYVRFLQQAMASTEPLPPTQPRHMMPRQQ 178



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C048
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.