DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16813 and Mabi

DIOPT Version :9

Sequence 1:NP_001260438.1 Gene:CG16813 / 34724 FlyBaseID:FBgn0032490 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster


Alignment Length:205 Identity:58/205 - (28%)
Similarity:78/205 - (38%) Gaps:52/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YNHKKF--------------------TGALKRKRS-MDAD--------SDDDVVFIMEQPGQRTP 39
            |.||||                    :|.....|| .||.        ||.|..|          
  Fly     7 YRHKKFDMGRKIEKCDLQLKEELISRSGTPCTSRSPFDAANQSVSLGFSDQDADF---------- 61

  Fly    40 EQPQPKRRFFRPWMDESPEEEQPQPPRKIVATSTPPPQQVDGTYHANMVRNHHKRRQRSPQEQLR 104
             .|.||||  |.....|....|...|  |:   |...|.: ..||.||||...| ::|||::|.|
  Fly    62 -PPLPKRR--RLGSSSSSVSYQSASP--II---TEAIQDI-FKYHVNMVRKFPK-KERSPKDQER 116

  Fly   105 RDRNTLASLRHRRSQQQQQQLIEQQYLTSRIQHEANLQQQIRLSLYYVRFLQQAMASTEPLPPTQ 169
            |::||:|....||.::.....|||||.....:|....:|.:|..:|.....|.......||..::
  Fly   117 RNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLVKQEDHPLVSSR 181

  Fly   170 PRHMMPRQQT 179
               .:|.:.|
  Fly   182 ---RVPEENT 188



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C048
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.