Sequence 1: | NP_001260438.1 | Gene: | CG16813 / 34724 | FlyBaseID: | FBgn0032490 | Length: | 184 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609624.1 | Gene: | Mabi / 34727 | FlyBaseID: | FBgn0032493 | Length: | 206 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 58/205 - (28%) |
---|---|---|---|
Similarity: | 78/205 - (38%) | Gaps: | 52/205 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 YNHKKF--------------------TGALKRKRS-MDAD--------SDDDVVFIMEQPGQRTP 39
Fly 40 EQPQPKRRFFRPWMDESPEEEQPQPPRKIVATSTPPPQQVDGTYHANMVRNHHKRRQRSPQEQLR 104
Fly 105 RDRNTLASLRHRRSQQQQQQLIEQQYLTSRIQHEANLQQQIRLSLYYVRFLQQAMASTEPLPPTQ 169
Fly 170 PRHMMPRQQT 179 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2C048 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0014326 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |