DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ski6 and RRP46

DIOPT Version :9

Sequence 1:NP_001260437.1 Gene:Ski6 / 34721 FlyBaseID:FBgn0032487 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_011609.2 Gene:RRP46 / 852987 SGDID:S000003327 Length:223 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:63/242 - (26%)
Similarity:107/242 - (44%) Gaps:55/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IKCKLGVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQ-------TESVINCQYSQATFSTAERK 83
            ::.::|:.:..|||:.....:|||:.:|.||.:.|..|       .|.::......||  |.|  
Yeast     3 VQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVAT--TRE-- 63

  Fly    84 NRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVLQ--DDGANYAV-----ALNAATLA 141
                   |.||.|  |:..|:..|....|||....|..::|:  :|.|.:::     .:|||.||
Yeast    64 -------KVLEDK--LRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLA 119

  Fly   142 LIDAGICLN---------------EFIVACTASLSKSNIPLTDISQFEEVSGGPKLTVAALPTAE 191
            |:||||.||               :.||..||...|.::.:..:: .|.|:||        ...:
Yeast   120 LVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLA-LEFVNGG--------KVVK 175

  Fly   192 KIAFLEMSERFHIDHLETVIETAMAGCRE----IRDILEAAVKEHLL 234
            .:..|:.:..|:.|.|.:::|.....|:|    ||.|::..:...|:
Yeast   176 NVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ski6NP_001260437.1 PRK03983 7..231 CDD:235187 62/237 (26%)
RNase_PH_RRP41 12..233 CDD:206775 62/239 (26%)
RRP46NP_011609.2 RNase_PH_RRP46 4..210 CDD:206777 59/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.