DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ski6 and exosc5

DIOPT Version :9

Sequence 1:NP_001260437.1 Gene:Ski6 / 34721 FlyBaseID:FBgn0032487 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001038817.2 Gene:exosc5 / 751632 ZFINID:ZDB-GENE-060503-675 Length:230 Species:Danio rerio


Alignment Length:217 Identity:58/217 - (26%)
Similarity:100/217 - (46%) Gaps:12/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRRIKCKLGVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQTESVINCQYSQATFSTAERKNRPR 87
            ||....:..:..:||||:...||:|.:||.||||.:.|      |....|.:|   |.|...:|:
Zfish    22 LREYGSEQSLLSRPDGSSTFVQGDTSILAGVYGPAEVK------VSKEIYDRA---TVEVLIQPK 77

  Fly    88 GDRKSLEFKL---YLQQALSAAIKSELYPRSQIDIYVEVLQDDGANYAVALNAATLALIDAGICL 149
            ....|:..:.   .:::...||:...|:|||.:.:.::|:.|||:..:..||||.:||:|||:.:
Zfish    78 MGLPSVRERAREQCVRETCEAALLLTLHPRSSLTVILQVVHDDGSLLSCCLNAACMALMDAGLPM 142

  Fly   150 NEFIVACTASLSKSNIPLTDISQFEEVSGGPKLTVAALPTAEKIAFLEMSERFHIDHLETVIETA 214
            :....:.|.::||....:||.:..:|......||.|.......:.....:..|.:..|:..|..:
Zfish   143 SRLFCSVTCAISKEGQIITDPTARQEKESRALLTFAIDSNERNVLMSSTTGSFSVQELQQCIAIS 207

  Fly   215 MAGCREIRDILEAAVKEHLLHM 236
            .....:|......:||.....|
Zfish   208 QKASEQIFQFYRDSVKRRYSKM 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ski6NP_001260437.1 PRK03983 7..231 CDD:235187 56/210 (27%)
RNase_PH_RRP41 12..233 CDD:206775 57/212 (27%)
exosc5NP_001038817.2 Rph 17..216 CDD:223761 55/202 (27%)
RNase_PH_RRP46 22..219 CDD:206777 55/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.