DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ski6 and exosc6

DIOPT Version :9

Sequence 1:NP_001260437.1 Gene:Ski6 / 34721 FlyBaseID:FBgn0032487 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001018322.1 Gene:exosc6 / 326786 ZFINID:ZDB-GENE-050522-362 Length:271 Species:Danio rerio


Alignment Length:233 Identity:71/233 - (30%)
Similarity:118/233 - (50%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SEQGLRLDGRRPHELRRIKCKLGVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQTESV----IN 69
            |.||:|.:|    ::|.:..:.|:..|..||||:|.||||::.:||||.:.:......:    :.
Zfish    32 SRQGVRGNG----DVRPVFARCGLVSQAKGSAYIEAGNTKIICSVYGPKETERRDETDMKTGRLV 92

  Fly    70 CQYSQATFSTAERKNRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVLQDDGANYAVA 134
            |.:..|.||..:|....:|..:. :....|.::|...:....|||||||:.|.||::||:..|.|
Zfish    93 CDFRLAPFSCVKRGAWIQGSEER-DLSATLMESLRPGVCLHRYPRSQIDVNVMVLENDGSVLAHA 156

  Fly   135 LNAATLALIDAGICLNEFIVACTASLSKSNIPLTDISQFEEVSGGPK--------LTVAALPTAE 191
            :..|::||.||||.:.:.::.||...| .|..|.|.|..||.....:        :|:|.||...
Zfish   157 VTCASMALADAGIEMYDIVLGCTLRQS-GNACLVDPSYAEECGSWQEGYGDNQGCVTLALLPNLN 220

  Fly   192 KIAFLEMSERFHIDHLETVIETAMAGCREIRDILEAAV 229
            :::.|........|.|...:.|.|.||.::..:::.|:
Zfish   221 QVSGLNADGEMREDTLTEAMRTCMDGCHKLYPVVQQAL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ski6NP_001260437.1 PRK03983 7..231 CDD:235187 71/233 (30%)
RNase_PH_RRP41 12..233 CDD:206775 69/230 (30%)
exosc6NP_001018322.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 4/6 (67%)
ECX1 30..258 CDD:131120 70/231 (30%)
RNase_PH_MTR3 42..258 CDD:206776 65/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.