DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ski6 and Exosc5

DIOPT Version :9

Sequence 1:NP_001260437.1 Gene:Ski6 / 34721 FlyBaseID:FBgn0032487 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001100963.2 Gene:Exosc5 / 308441 RGDID:1307861 Length:235 Species:Rattus norvegicus


Alignment Length:227 Identity:65/227 - (28%)
Similarity:104/227 - (45%) Gaps:29/227 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSEQGLRLDGRRP-HELRRIKCKLGVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQTESVINC 70
            :|::.|.....|.| ..||...|:..:..:|||||...||:|.|||.||||.:.|  .::.:.| 
  Rat    11 VLTDTGTESSPRSPVCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVK--VSKEIFN- 72

  Fly    71 QYSQATFSTAER----------KNRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVLQ 125
               :||.....|          |:|.|..|.:.|          |.:...|:||:.|.:.::|:.
  Rat    73 ---KATLEVILRPKIGLPGVAEKSRERLIRNTCE----------AVVLGALHPRTSITVVLQVVS 124

  Fly   126 DDGANYAVALNAATLALIDAGICLNEFIVACTASLSKSNIPLTDISQFEEVSGGPKLTVAALPTA 190
            |.|:..|..||||.:||:|||:.:.......|.:|......:.|.:..:|......||. ||.:|
  Rat   125 DTGSLLACCLNAACMALVDAGVPMRALFCGVTCALDPDGNLVLDPTTKQEKEARAILTF-ALDSA 188

  Fly   191 EKIAFLEMSERFHID-HLETVIETAMAGCREI 221
            |:...:..::..:.| .|:..:..|.|..:.|
  Rat   189 EQKLLMSATKGLYSDAELQQCLAAAQAASQHI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ski6NP_001260437.1 PRK03983 7..231 CDD:235187 65/227 (29%)
RNase_PH_RRP41 12..233 CDD:206775 64/222 (29%)
Exosc5NP_001100963.2 ECX1 10..232 CDD:131120 65/227 (29%)
RNase_PH_RRP46 28..225 CDD:206777 61/210 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.