DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ski6 and Exosc6

DIOPT Version :9

Sequence 1:NP_001260437.1 Gene:Ski6 / 34721 FlyBaseID:FBgn0032487 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_006255676.1 Gene:Exosc6 / 307850 RGDID:1309832 Length:312 Species:Rattus norvegicus


Alignment Length:241 Identity:77/241 - (31%)
Similarity:119/241 - (49%) Gaps:19/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RRPHELRRIKCKLGVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQ---------------TESV 67
            |.|..||.:..:.|:..|..||||:|.|.||||.||.||.||:|.:               ....
  Rat    71 RDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGR 135

  Fly    68 INCQYSQATFSTAERKNRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVLQDDGANYA 132
            :.|.:.:|.|| ..|:..|:|..:..|..|.||:||..|::...|||:|:::...:|:|.|:..|
  Rat   136 LLCDFRRAPFS-GRRRRAPQGSSEDRELGLALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALA 199

  Fly   133 VALNAATLALIDAGICLNEFIVACTASLSKSNIP--LTDISQFEEVSGGPKLTVAALPTAEKIA- 194
            .||.||.|||.|||:.:.:.:|.|..||:....|  |.|.::.||......||||.:|...::| 
  Rat   200 AALTAAALALADAGVEMYDLVVGCGLSLTPGPSPTWLLDPTRLEEEHSEAGLTVALMPVLNQVAG 264

  Fly   195 FLEMSERFHIDHLETVIETAMAGCREIRDILEAAVKEHLLHMGSAS 240
            .|...|....:.....:...:.||:.:..:|:..:.......|:|:
  Rat   265 LLGSGEGGQTESWTDAVRLGLEGCQRLYPVLQQCLVRAARRRGAAA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ski6NP_001260437.1 PRK03983 7..231 CDD:235187 75/230 (33%)
RNase_PH_RRP41 12..233 CDD:206775 75/232 (32%)
Exosc6XP_006255676.1 ECX1 71..299 CDD:131120 75/228 (33%)
RNase_PH_MTR3 76..300 CDD:206776 73/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.