DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ski6 and Exosc5

DIOPT Version :9

Sequence 1:NP_001260437.1 Gene:Ski6 / 34721 FlyBaseID:FBgn0032487 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_613052.1 Gene:Exosc5 / 27998 MGIID:107889 Length:235 Species:Mus musculus


Alignment Length:228 Identity:66/228 - (28%)
Similarity:105/228 - (46%) Gaps:29/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLLSEQGLRLDGRRP-HELRRIKCKLGVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQTESVIN 69
            :||::.|.....|.| ..||...|:..:..:|||||...||:|.|||.||||.:.|  .::.:.|
Mouse    10 NLLTDTGTESSPRSPVCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVK--VSKEIFN 72

  Fly    70 CQYSQATFSTAER----------KNRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVL 124
                :||.....|          |:|.|..|.:.|          |.:...|:||:.|.:.::|:
Mouse    73 ----KATLEVILRPKIGLPGVAEKSRERLVRNTCE----------AVVLGALHPRTSITVVLQVV 123

  Fly   125 QDDGANYAVALNAATLALIDAGICLNEFIVACTASLSKSNIPLTDISQFEEVSGGPKLTVAALPT 189
            .|.|:..|..||||.:||:|||:.:.......|.:|......:.|.:..:|......||. ||.:
Mouse   124 SDAGSLLACCLNAACMALVDAGVPMRALFCGVTCALDSDGNLVLDPTTKQEKEARAILTF-ALDS 187

  Fly   190 AEKIAFLEMSERFHID-HLETVIETAMAGCREI 221
            ||:...:..::..:.| .|:..:..|.|..:.|
Mouse   188 AEQKLLMSTTKGLYSDAELQQCLAAAQAASQHI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ski6NP_001260437.1 PRK03983 7..231 CDD:235187 66/227 (29%)
RNase_PH_RRP41 12..233 CDD:206775 64/222 (29%)
Exosc5NP_613052.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 3/10 (30%)
ECX1 11..232 CDD:131120 66/227 (29%)
RNase_PH_RRP46 28..225 CDD:206777 61/210 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53663
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.