DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mRF1 and MTRFR

DIOPT Version :9

Sequence 1:	NP_609617.1	Gene:	mRF1 / 34720	FlyBaseID:	FBgn0032486	Length:	392	Species:	Drosophila melanogaster
Sequence 2:	NP_001137377.1	Gene:	MTRFR / 91574	HGNCID:	26784	Length:	166	Species:	Homo sapiens

Alignment Length:	100	Identity:	26/100 - (26%)
Similarity:	49/100 - (49%)	Gaps:	10/100 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   238 EKDLKIETKRASGAGGQHVNTTDSAVRIVHLPTGLAVEAQSERSQLKNRELAMKRLRSRL----- 297
            |.:|:.:..:..|.|||..|.|.:.|.:.|:|:|:.|:....||..:||:||.|.|:.::
Human    57 ENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYN 121

  Fly   298 -----VQQQLESVEASKMATKKAQQGSLNRNEKIR 327
                 |.::.......|...||..:.:|.:.:.::
Human   122 GENSPVHKEKREAAKKKQERKKRAKETLEKKKLLK 156

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mRF1	NP_609617.1	prfA	35..378	CDD:234801	26/99 (26%)
		PCRF	58..222	CDD:281461
		RF-1	234..338	CDD:278876	26/99 (26%)
MTRFR	NP_001137377.1	RF-1	53..>116	CDD:306878	21/58 (36%)
		GGQ domain. /evidence=ECO:0000250\|UniProtKB:Q80VP5	57..121		21/63 (33%)
		GGQ. /evidence=ECO:0000269\|PubMed:24198383	71..73		1/1 (100%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	122..148		4/25 (16%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810