DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRF1 and AT1G33330

DIOPT Version :9

Sequence 1:NP_609617.1 Gene:mRF1 / 34720 FlyBaseID:FBgn0032486 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001319132.1 Gene:AT1G33330 / 840227 AraportID:AT1G33330 Length:257 Species:Arabidopsis thaliana


Alignment Length:142 Identity:48/142 - (33%)
Similarity:68/142 - (47%) Gaps:15/142 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LRYEAGVHRVQRVPATEKSGRMHTSTASITVIPRPADIQ----VHIAEKDL----KIETKRASGA 251
            |||.:.    ..|......|.......|::|:   :|:|    :...:::|    ::||.|.||.
plant    51 LRYSSS----DGVNGGSSGGDFGNDNDSVSVV---SDVQSPNYLKFTDEELMKQCRLETFRVSGP 108

  Fly   252 GGQHVNTTDSAVRIVHLPTGLAVEAQSERSQLKNRELAMKRLRSRLVQQQLESVEASKMATKKAQ 316
            ||||.|..|||||:.|||||:..:|..:|||.|||..|:.|||:.|..:....|:....|.....
plant   109 GGQHRNKRDSAVRLKHLPTGIVAQAVEDRSQHKNRASALNRLRTLLAIKVRNKVDIEAYAPPPEL 173

  Fly   317 QGSLNRNEKIRT 328
            ...|.....|||
plant   174 LQILPPKSTIRT 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRF1NP_609617.1 prfA 35..378 CDD:234801 48/142 (34%)
PCRF 58..222 CDD:281461 5/26 (19%)
RF-1 234..338 CDD:278876 39/99 (39%)
AT1G33330NP_001319132.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43804
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.