DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRF1 and Mtrfr

DIOPT Version :9

Sequence 1:NP_609617.1 Gene:mRF1 / 34720 FlyBaseID:FBgn0032486 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001128189.1 Gene:Mtrfr / 72650 MGIID:1919900 Length:184 Species:Mus musculus


Alignment Length:155 Identity:37/155 - (23%)
Similarity:68/155 - (43%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RVQRVPATEKSGRMHTSTASI-------TVIPRPADIQVHIAEKDLKIETKRASGAGGQHVNTTD 260
            |:|..||....| |..||..:       .::|        :.|.:|:.:..:..|.|||..|.|.
Mouse    27 RLQEKPALLFPG-MAASTVQVAGRKDYPALLP--------LNESELEEQFVKGHGPGGQATNKTS 82

  Fly   261 SAVRIVHLPTGLAVEAQSERSQLKNRELAMKRLRSRL----------VQQQLESVEASKMATKKA 315
            :.|.:.|:|:|:.|:....||..:||::|.|.|:.::          |.::....|..|...||.
Mouse    83 NCVVLKHVPSGIVVKCHQTRSVDQNRKIARKVLQEKVDVFYNGENSPVHKEKLEAERRKRERKKR 147

  Fly   316 QQGSLNRNEKIRTYNFVQDRITDHR 340
            .:.:|.:.:.::........||:.:
Mouse   148 AKETLEKKKLLKELREASQNITEKK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRF1NP_609617.1 prfA 35..378 CDD:234801 37/155 (24%)
PCRF 58..222 CDD:281461 8/18 (44%)
RF-1 234..338 CDD:278876 27/113 (24%)
MtrfrNP_001128189.1 RF-1 58..>119 CDD:278876 20/60 (33%)
GGQ domain. /evidence=ECO:0000269|PubMed:22821833 60..124 20/63 (32%)
GGQ. /evidence=ECO:0000269|PubMed:22821833 74..76 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..184 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.