DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRF1 and CG6094

DIOPT Version :9

Sequence 1:NP_609617.1 Gene:mRF1 / 34720 FlyBaseID:FBgn0032486 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001260353.1 Gene:CG6094 / 34446 FlyBaseID:FBgn0032261 Length:203 Species:Drosophila melanogaster


Alignment Length:144 Identity:39/144 - (27%)
Similarity:65/144 - (45%) Gaps:15/144 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 LKIETKRASGAGGQHVNTTDSAVRIVHLPTGLAVEAQSERSQLKNRELAMKRLRSRLVQQQLESV 305
            |:|...|:||.|||||||.::.|.:      ....||::....:.|:..:|.|.:|:.:.....:
  Fly    70 LEITYSRSSGPGGQHVNTVNTKVDV------RFKVAQADWIPEQTRQKLLKVLANRITKDGYFYI 128

  Fly   306 EASKMATKKAQQGSLNRNEKIRTYNFVQDRITDHRIQGGTLHNLNGFLKGGDQLSGLIEKLQLEH 370
            ::.  .|:..|....:..||:||....|:.:........||..|.     ..|...:.|:|||:.
  Fly   129 KSD--LTRSQQMNLADALEKLRTIIRSQEAVAPAPPSEETLEKLR-----RRQERAVRERLQLKR 186

  Fly   371 RRERLKELLDRWEP 384
            .|.::|  .||..|
  Fly   187 GRAQVK--ADRQGP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRF1NP_609617.1 prfA 35..378 CDD:234801 36/136 (26%)
PCRF 58..222 CDD:281461
RF-1 234..338 CDD:278876 26/96 (27%)
CG6094NP_001260353.1 PRK09256 65..200 CDD:181730 39/144 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.