DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRF1 and Mtrf1

DIOPT Version :9

Sequence 1:NP_609617.1 Gene:mRF1 / 34720 FlyBaseID:FBgn0032486 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017171428.1 Gene:Mtrf1 / 211253 MGIID:2384815 Length:462 Species:Mus musculus


Alignment Length:375 Identity:140/375 - (37%)
Similarity:218/375 - (58%) Gaps:23/375 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QNEKLQAYLESLRQEYYAVRVNAAGNSKS----------YARLAQLEGVVSAL-EQRRVLERHIT 80
            :::.||.|:|.|.:||..:.....|.|::          :|:||.|..|...: |..:.:|...:
Mouse    83 KHKALQKYMEDLNKEYQTLDQCLQGISENEGDRRALHRRHAQLAPLAAVYQEIQEAEQAIEELES 147

  Fly    81 SAKDMEAEKDEDMRELMREENEVYVDLLGKQDQALLQELLTLSDDEEYPALIFGLNAG--AGGQE 143
            ..|.:..:.::.::||:.||.::....:.:....||:.|:. .:..::..:|..:.:|  .||..
Mouse   148 LCKSLNKQDEKQLQELVSEERQIIDQKIHRLYSELLERLVP-KEKYDWSDVILEVTSGRTTGGDI 211

  Fly   144 AMLFAQELYEMYTGYFEHMGWEWEEFASEGTDIGGLRHASLMVSGEDAFRWLRYEAGVHRVQRVP 208
            ...|.:|:::||..|..:..|::|.......|.|||.||:..:||:..::.|:||.|:|||||:|
Mouse   212 CQQFTREIFDMYQNYSYYKHWKFELLNYTPADYGGLHHAAARISGDSVYKHLKYEGGIHRVQRIP 276

  Fly   209 ATEKSGRM---HTSTASITVIPRPADI-----QVHIAEKDLKIETKRASGAGGQHVNTTDSAVRI 265
            ....|.||   ||.|.|:.|:|:|.::     .|.:..|||:::|.||.|||||||||||||||:
Mouse   277 EVGLSSRMQRIHTGTMSVIVLPQPDEVTSPGQDVKVDPKDLRVDTFRARGAGGQHVNTTDSAVRL 341

  Fly   266 VHLPTGLAVEAQSERSQLKNRELAMKRLRSRLVQQQLESVEASKMATKKAQQGSLNRNEKIRTYN 330
            ||:||||.||.|.|||||||:|:|::.||:||.||.:|.....:...:|.|.|:..::|:|||||
Mouse   342 VHIPTGLVVECQQERSQLKNKEIALRVLRARLYQQIIEKDRCQQQNARKLQVGTRAQSERIRTYN 406

  Fly   331 FVQDRITDHRIQGGTLHNLNGFLKGGDQLSGLIEKLQLEHRRERLKELLD 380
            |.|||:||||| ...:.::..||:|...|..|||:|......|.:.|.||
Mouse   407 FTQDRVTDHRI-AYEVRDIKEFLRGEKCLDQLIERLLQSADEEAISEFLD 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRF1NP_609617.1 prfA 35..378 CDD:234801 134/363 (37%)
PCRF 58..222 CDD:281461 49/169 (29%)
RF-1 234..338 CDD:278876 60/103 (58%)
Mtrf1XP_017171428.1 prfA 116..452 CDD:234801 128/337 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4523
eggNOG 1 0.900 - - E1_COG0216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 283 1.000 Inparanoid score I2853
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62484
OrthoDB 1 1.010 - - D1313171at2759
OrthoFinder 1 1.000 - - FOG0001423
OrthoInspector 1 1.000 - - otm43404
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43804
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X991
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.